Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Placenta growth factor (PGF) (Active)

Recombinant Human Placenta growth factor (PGF) (Active)

SKU:P49763-3

Regular price ¥94,200 JPY
Regular price Sale price ¥94,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cardiovascular

Uniprot ID: P49763-3

Gene Names: PGF

Alternative Name(s): Placenta growth factor; PlGF; PGF; PGFL, PLGF

Abbreviation: Recombinant Human PGF protein (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 19-170aa

Protein Length: Full Length of Mature Protein of Isoform PlGF-2

Tag Info: C-terminal hFc1-tagged

Target Protein Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

MW: 45.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.

Reference: HRG inhibits tumor growth and metastasis by inducing macrophage polarization and vessel normalization through downregulation of PlGF. Rolny C., Mazzone M., Tugues S., Laoui D., Johansson I., Coulon C., Squadrito M.L., Segura I., Li X., Carmeliet P. Cancer Cell 19: 31-44 (2011)

Function:

View full details