Recombinant Human Phosphoserine phosphatase(PSPH)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Phosphoserine phosphatase(PSPH)

CSB-EP018938HU
Regular price
¥105,600 JPY
Sale price
¥105,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P78330

Gene Names: PSPH

Organism: Homo sapiens (Human)

AA Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Expression Region: 1-225aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 52 kDa

Alternative Name(s): L-3-phosphoserine phosphatase O-phosphoserine phosphohydrolase

Relevance: Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates

Reference: "Human L-3-phosphoserine phosphatase: sequence, expression and evidence for a phosphoenzyme intermediate." Collet J.-F., Gerin I., Rider M.H., Veiga-Da-Cunha M., Van Schaftingen E. FEBS Lett. 408:281-284(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Phosphoethanolamine-phosphocholine phosphatase(PHOSPHO1)
    Regular price
    ¥135,100 JPY
    Sale price
    ¥135,100 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial
    Regular price
    ¥105,600 JPY
    Sale price
    ¥105,600 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase(LHPP)
    Regular price
    ¥105,600 JPY
    Sale price
    ¥105,600 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Serine-threonine-protein phosphatase 2A catalytic subunit beta isoform(PPP2CB)
    Regular price
    ¥105,600 JPY
    Sale price
    ¥105,600 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share