Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit P(PIGP)

Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit P(PIGP)

SKU:CSB-CF017979HU

Regular price ¥269,600 JPY
Regular price Sale price ¥269,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P57054

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFI PESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAK NQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN

Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase subunit P EC= 2.4.1.198 Alternative name(s): Down syndrome critical region protein 5 Down syndrome critical region protein C Phosphatidylinositol-glycan biosynth

Gene Names:Name:PIGP Synonyms:DCRC, DSCR5, DSCRC ORF Names:NPD010

Expression Region:1-158

Sequence Info:Full length protein

View full details