Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP11(FKBP11)

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP11(FKBP11)

SKU:CSB-CF878925HU

Regular price ¥272,700 JPY
Regular price Sale price ¥272,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NYL4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIEL GQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRAN YWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK

Protein Names:Recommended name: Peptidyl-prolyl cis-trans isomerase FKBP11 Short name= PPIase FKBP11 EC= 5.2.1.8 Alternative name(s): 19 kDa FK506-binding protein Short name= 19 kDa FKBP Short name= FKBP-19 FK506-binding protein

Gene Names:Name:FKBP11 Synonyms:FKBP19 ORF Names:UNQ336/PRO535

Expression Region:28-201

Sequence Info:full length protein

View full details