Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human PDZK1-interacting protein 1(PDZK1IP1)

Recombinant Human PDZK1-interacting protein 1(PDZK1IP1)

SKU:CSB-CF621650HU

Regular price ¥253,900 JPY
Regular price Sale price ¥253,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q13113

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPE PAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM

Protein Names:Recommended name: PDZK1-interacting protein 1 Alternative name(s): 17 kDa membrane-associated protein Protein DD96

Gene Names:Name:PDZK1IP1 Synonyms:MAP17

Expression Region:1-114

Sequence Info:full length protein

View full details