Recombinant Human Olfactory receptor 1A1(OR1A1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Olfactory receptor 1A1(OR1A1)

CSB-CF865201HU
Regular price
¥134,300 JPY
Sale price
¥134,300 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug

Updated Date: Stock Protein updated on 20171228

Research areas: Neuroscience

Target / Protein: OR1A1

Biologically active: Not Tested

Expression system: in vitro E.coli expression system

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q9P1Q5

AA Sequence: MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-309aa

Protein length: Full Length

MW: 50.6 kDa

Alternative Name(s): Olfactory receptor 17-7

Relevance: Odorant receptor.

Reference: "Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2." Schmiedeberg K., Shirokova E., Weber H.P., Schilling B., Meyerhof W., Krautwurst D. J. Struct. Biol. 159:400-412(2007)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share