Recombinant Human NKG2-D type II integral membrane protein(KLRK1)

SKU: CSB-CF012474HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P26718

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Protein Names:Recommended name: NKG2-D type II integral membrane protein Alternative name(s): Killer cell lectin-like receptor subfamily K member 1 NK cell receptor D NKG2-D-activating NK receptor CD_antigen= CD314

Gene Names:Name:KLRK1 Synonyms:D12S2489E, NKG2D

Expression Region:1-216

Sequence Info:full length protein