Recombinant Human NEDD8-conjugating enzyme UBE2F(UBE2F)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human NEDD8-conjugating enzyme UBE2F(UBE2F)

CSB-EP850248HU
Regular price
¥105,100 JPY
Sale price
¥105,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q969M7

Gene Names: UBE2F

Organism: Homo sapiens (Human)

AA Sequence: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

Expression Region: 1-185aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 48.1 kDa

Alternative Name(s): NEDD8 carrier protein UBE2F NEDD8 protein ligase UBE2F NEDD8-conjugating enzyme 2 Ubiquitin-conjugating enzyme E2 F

Relevance: Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.

Reference: "E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification." Huang D.T., Ayrault O., Hunt H.W., Taherbhoy A.M., Duda D.M., Scott D.C., Borg L.A., Neale G., Murray P.J., Roussel M.F., Schulman B.A. Mol. Cell 33:483-495(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • UBE2M Antibody - Cat. #: CSB-PA025468OA01HU
    Regular price
    ¥55,300 JPY
    Sale price
    ¥55,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human NCE2
    Regular price
    ¥99,200 JPY
    Sale price
    ¥99,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human UBE2M
    Regular price
    ¥99,200 JPY
    Sale price
    ¥99,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • UBE2F antibody , Cat. # FNab09173
    Regular price
    ¥64,400 JPY
    Sale price
    ¥64,400 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share