Skip to product information
1 of 1

GeneBio Systems

Recombinant Human N-formyl peptide receptor 2 (FPR2)-VLPs

Recombinant Human N-formyl peptide receptor 2 (FPR2)-VLPs

SKU:P25090

Regular price ¥265,900 JPY
Regular price Sale price ¥265,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: P25090

Gene Names: FPR2

Alternative Name(s): FMLP-related receptor I (FMLP-R-I);Formyl peptide receptor-like 1;HM63;Lipoxin A4 receptor (LXA4 receptor);RFP

Abbreviation: Recombinant Human FPR2 protein-VLPs

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 1-351aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Target Protein Sequence: METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM

MW: 40.3 kDa

Purity: The purity information is not available for VLPs proteins.

Endotoxin: Not test

Biological_Activity:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Relevance: Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (PubMed: 1374236). Binding of FMLP to the receptor causes activation of neutrophils.

Reference:

Function:

View full details