Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Monocyte to macrophage differentiation protein(MMD)

Recombinant Human Monocyte to macrophage differentiation protein(MMD)

SKU:CSB-CF614894HU

Regular price ¥283,400 JPY
Regular price Sale price ¥283,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q15546

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Protein Names:Recommended name: Monocyte to macrophage differentiation protein Alternative name(s): Progestin and adipoQ receptor family member 11 Progestin and adipoQ receptor family member XI

Gene Names:Name:MMD Synonyms:PAQR11

Expression Region:1-238

Sequence Info:full length protein

View full details