Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Mitochondrial inner membrane protease subunit 2(IMMP2L)

Recombinant Human Mitochondrial inner membrane protease subunit 2(IMMP2L)

SKU:CSB-CF822306HU

Regular price ¥271,100 JPY
Regular price Sale price ¥271,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q96T52

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE

Protein Names:Recommended name: Mitochondrial inner membrane protease subunit 2 EC= 3.4.21.- Alternative name(s): IMP2-like protein

Gene Names:Name:IMMP2L

Expression Region:1-175

Sequence Info:full length protein

View full details