Recombinant Human Metallothionein-3(MT3)

Recombinant Human Metallothionein-3(MT3)

CSB-EP015122HU
Regular price
¥81,500 JPY
Sale price
¥81,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Neuroscience

Target / Protein: MT3

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P25713

AA Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-68aa

Protein length: Full Length

MW: 22.9 kDa

Alternative Name(s): GIFB Short name: GIF Growth inhibitory factor Metallothionein-III Short name: MT-III

Relevance: Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Reference: "The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein."Uchida Y., Takio K., Titani K., Ihara Y., Tomonaga M.Neuron 7:337-347(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share