Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Membrane-spanning 4-domains subfamily A member 7(MS4A7)

Recombinant Human Membrane-spanning 4-domains subfamily A member 7(MS4A7)

SKU:CSB-CF875636HU

Regular price ¥246,500 JPY
Regular price Sale price ¥246,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9GZW8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLIS SLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTS NAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVS LTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI

Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 7 Alternative name(s): CD20 antigen-like 4 CD20/FC-epsilon-RI-beta family member 4 Four-span transmembrane protein 2

Gene Names:Name:MS4A7 Synonyms:4SPAN2, CD20L4, CFFM4

Expression Region:1-240

Sequence Info:full length protein

View full details