Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Membrane-spanning 4-domains subfamily A member 6A(MS4A6A)

Recombinant Human Membrane-spanning 4-domains subfamily A member 6A(MS4A6A)

SKU:CSB-CF875659HU

Regular price ¥286,700 JPY
Regular price Sale price ¥286,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9H2W1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVL SLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVG SILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKA SLAGTLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDC GYEELLTS

Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 6A Alternative name(s): CD20 antigen-like 3 Four-span transmembrane protein 3

Gene Names:Name:MS4A6A Synonyms:4SPAN3, CD20L3, MS4A6 ORF Names:CDA01, MSTP090

Expression Region:1-248

Sequence Info:full length protein

View full details