Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Membrane-spanning 4-domains subfamily A member 5(MS4A5)

Recombinant Human Membrane-spanning 4-domains subfamily A member 5(MS4A5)

SKU:CSB-CF875668HU

Regular price ¥276,700 JPY
Regular price Sale price ¥276,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9H3V2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKILGTIQILFGIM TFSFGVIFLFTLLKPYPRFPFIFLSGYPFWGSVLFINSGAFLIAVKRKTTETLIILSRIM NFLSALGAIAGIILLTFGFILDQNYICGYSHQNSQCKAVTVLFLGILITLMTFSIIELFI SLPFSILGCHSEDCDCEQCC

Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 5 Alternative name(s): CD20 antigen-like 2 Testis-expressed transmembrane protein 4

Gene Names:Name:MS4A5 Synonyms:CD20L2, TETM4

Expression Region:1-200

Sequence Info:full length protein

View full details