Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Lysoplasmalogenase-like protein TMEM86A(TMEM86A)

Recombinant Human Lysoplasmalogenase-like protein TMEM86A(TMEM86A)

SKU:CSB-CF850787HU

Regular price ¥283,600 JPY
Regular price Sale price ¥283,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8N2M4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLG FLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRT GLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGADWRWTELAAG SGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVESREPVEHYRLTKAN

Protein Names:Recommended name: Lysoplasmalogenase-like protein TMEM86A Alternative name(s): Transmembrane protein 86A

Gene Names:Name:TMEM86A

Expression Region:1-240

Sequence Info:full length protein

View full details