
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Signal Transduction
Uniprot ID: O95868
Gene Names: LY6G6D
Organism: Homo sapiens (Human)
AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Expression Region: 10-104aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 10xHis-B2M-JD-tagged
MW: 15.5 kDa
Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein
Relevance:
Reference: "Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region." Ribas G., Neville M., Wixon J.L., Cheng J., Campbell R.D. J. Immunol. 163:278-287(1999)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D),partial
- Regular price
- ¥82,200 JPY
- Sale price
- ¥82,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)
- Regular price
- ¥105,100 JPY
- Sale price
- ¥105,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)
- Regular price
- ¥105,100 JPY
- Sale price
- ¥105,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)
- Regular price
- ¥91,800 JPY
- Sale price
- ¥91,800 JPY
- Regular price
-
- Unit price
- per
Sold out