Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) (F176V), partial (Active)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) (F176V), partial (Active)

SKU:P08637

Regular price ¥58,200 JPY
Regular price Sale price ¥58,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: P08637

Gene Names: FCGR3A

Alternative Name(s): CD16A

Abbreviation: Recombinant Human FCGR3A protein (F176V), partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 17-208aa(F176V)

Protein Length: Partial

Tag Info: C-terminal 10xHis-HSA-tagged

Target Protein Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

MW: 90.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Loaded Anti-Human CD16a Antibody (CSB-RA008543MA1HU) on 96-Flat plate, can bind Human CD16a(F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime).

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger.

Reference: Alternative membrane forms of Fc gamma RIII(CD16) on human natural killer cells and neutrophils. Cell type-specific expression of two genes that differ in single nucleotide substitutions. Ravetch J.V., Perussia B. J. Exp. Med. 170: 481-497 (1989)

Function:

View full details