Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a(FCGR2A)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a(FCGR2A)

SKU:CSB-CF008540HU

Regular price ¥293,600 JPY
Regular price Sale price ¥293,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P12318

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

Protein Names:Recommended name: Low affinity immunoglobulin gamma Fc region receptor II-a Short name= IgG Fc receptor II-a Alternative name(s): CDw32 Fc-gamma RII-a Short name= Fc-gamma-RIIa Short name= FcRII-a CD_antigen= CD32

Gene Names:Name:FCGR2A Synonyms:CD32, FCG2, FCGR2A1, IGFR2

Expression Region:34-317

Sequence Info:full length protein

View full details