Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

SKU:Q08722

Regular price ¥61,200 JPY
Regular price Sale price ¥61,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: Q08722

Gene Names: CD47

Alternative Name(s): Antigenic surface determinant protein OA3(Integrin-associated protein)(IAP)(Protein MER6)(CD47)

Abbreviation: Recombinant Human CD47 protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 19-139aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

MW: 15.1 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD47 (CSB-MP004940HUd7) at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 1.343-1.561 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.

Reference: "An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains." Campbell I.G., Freemont P.S., Foulkes W., Trowsdale J. Cancer Res. 52: 5416-5420(1992)

Function:

View full details