Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Leucine-rich repeat-containing protein 3B(LRRC3B)

Recombinant Human Leucine-rich repeat-containing protein 3B(LRRC3B)

SKU:CSB-CF857000HU

Regular price ¥281,000 JPY
Regular price Sale price ¥281,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q96PB8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVL NLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTL QQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGW FTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV

Protein Names:Recommended name: Leucine-rich repeat-containing protein 3B Alternative name(s): Leucine-rich repeat protein LRP15

Gene Names:Name:LRRC3B Synonyms:LRP15 ORF Names:UNQ195/PRO221

Expression Region:34-259

Sequence Info:full length protein

View full details