Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human L-selectin(SELL)

Recombinant Human L-selectin(SELL)

SKU:CSB-CF020977HU

Regular price ¥297,000 JPY
Regular price Sale price ¥297,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P14151

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY

Protein Names:Recommended name: L-selectin Alternative name(s): CD62 antigen-like family member L Leukocyte adhesion molecule 1 Short name= LAM-1 Leukocyte surface antigen Leu-8 Leukocyte-endothelial cell adhesion molecule 1 Short name= LECAM1 Lymph node homing receptor TQ1 gp90-MEL CD_antigen= CD62L

Gene Names:Name:SELL Synonyms:LNHR, LYAM1

Expression Region:39-372

Sequence Info:full length protein

View full details