Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Kita-kyushu lung cancer antigen 1(KKLC1)

Recombinant Human Kita-kyushu lung cancer antigen 1(KKLC1)

SKU:CSB-YP711093HU

Regular price ¥157,800 JPY
Regular price Sale price ¥157,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q5H943

Gene Names: CT83

Organism: Homo sapiens (Human)

AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Expression Region: 1-113aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 14.8 kDa

Alternative Name(s): Cancer/testis antigen 83

Relevance:

Reference: "Frequent High Expression of Kita-Kyushu Lung Cancer Antigen-1 (KK-LC-1) in Gastric Cancer." Shida A., Futawatari N., Fukuyama T., Ichiki Y., Takahashi Y., Nishi Y., Kobayashi N., Yamazaki H., Watanabe M. Anticancer Res. 35:3575-3579(2015)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details