Gene Bio Systems
Recombinant Human Kita-kyushu lung cancer antigen 1(KKLC1)
Recombinant Human Kita-kyushu lung cancer antigen 1(KKLC1)
SKU:CSB-YP711093HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: Q5H943
Gene Names: CT83
Organism: Homo sapiens (Human)
AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Expression Region: 1-113aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 14.8 kDa
Alternative Name(s): Cancer/testis antigen 83
Relevance:
Reference: "Frequent High Expression of Kita-Kyushu Lung Cancer Antigen-1 (KK-LC-1) in Gastric Cancer." Shida A., Futawatari N., Fukuyama T., Ichiki Y., Takahashi Y., Nishi Y., Kobayashi N., Yamazaki H., Watanabe M. Anticancer Res. 35:3575-3579(2015)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
