Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Interleukin-19 (IL19), Biotinylated

Recombinant Human Interleukin-19 (IL19), Biotinylated

SKU:Q9UHD0

Regular price ¥124,000 JPY
Regular price Sale price ¥124,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: Q9UHD0

Gene Names: IL19

Alternative Name(s): IL-19;Melanoma differentiation-associated protein-like protein;NG.1

Abbreviation: Recombinant Human IL19 protein, Biotinylated

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 25-177aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Target Protein Sequence: LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

MW: 65.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cytokine that functions as an anti-inflammatory and proangiogenic factor. Polarizes adaptive immunity to an anti-inflammatory phenotype through induction of T-helper 2 responses by both down-regulation of IFN-gamma and up-regulation of IL4 and IL13. Produced by osteocytes, stimulates granulopoiesis and neutrophil formation. Exerts its biological effect through a receptor complex consisting of a heterodimer of IL20RA and IL20RB. In turn, activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, and importantly, STAT3.

Reference:

Function:

View full details