Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interferon-induced transmembrane protein 2(IFITM2)

Recombinant Human Interferon-induced transmembrane protein 2(IFITM2)

SKU:CSB-CF011025HU-GB

Regular price ¥262,900 JPY
Regular price Sale price ¥262,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q01629

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWS LFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILL IIIPVLVVQAQR

Protein Names:Recommended name: Interferon-induced transmembrane protein 2 Alternative name(s): Interferon-inducible protein 1-8D

Gene Names:Name:IFITM2

Expression Region:1-132

Sequence Info:Full length protein

View full details