Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interferon alpha-inducible protein 6(IFI6)

Recombinant Human Interferon alpha-inducible protein 6(IFI6)

SKU:CSB-EP011016HU-GB

Regular price ¥126,700 JPY
Regular price Sale price ¥126,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: P09912

Gene Names: IFI6

Organism: Homo sapiens (Human)

AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

Expression Region: 24-130aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 24.4 kDa

Alternative Name(s): Interferon-induced protein 6-16

Relevance:

Reference: "Inhibition of G1P3 expression found in the differential display study on respiratory syncytial virus infection." Zhao D., Peng D., Li L., Zhang Q., Zhang C. Virol. J. 5:114-114(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details