Gene Bio Systems
Recombinant Human Interferon alpha-inducible protein 27, mitochondrial(IFI27)
Recombinant Human Interferon alpha-inducible protein 27, mitochondrial(IFI27)
SKU:CSB-CF011009HU-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P40305
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGA TGLSGLTKFILGSIGSAIAAVIARFY
Protein Names:Recommended name: Interferon alpha-inducible protein 27, mitochondrial Short name= p27 Alternative name(s): Interferon alpha-induced 11.5 kDa protein Interferon-stimulated gene 12a protein Short name= ISG12(a)
Gene Names:Name:IFI27
Expression Region:34-119
Sequence Info:Full length protein
