Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Insulin growth factor-like family member 1(IGFL1)

Recombinant Human Insulin growth factor-like family member 1(IGFL1)

SKU:CSB-EP764932HU

Regular price ¥149,600 JPY
Regular price Sale price ¥149,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:Q6UW32

Gene Names:IGFL1

Organism:Homo sapiens (Human)

AA Sequence:APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Expression Region:25-110aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:16.8 kDa

Alternative Name(s):IGFL1; UNQ644/PRO1274; Insulin growth factor-like family member 1

Relevance:Probable ligand of the IGFLR1 cell membrane receptor.

Reference:"Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1." Lobito A.A., Ramani S.R., Tom I., Bazan J.F., Luis E., Fairbrother W.J., Ouyang W., Gonzalez L.C. J. Biol. Chem. 286:18969-18981(2011)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Probable ligand of the IGFLR1 cell membrane receptor.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:IGFL family

Tissue Specificity:Detected in ovary and spinal cord.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:24093

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=546554

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:374918

STRING Database Link:

OMIM Database Link:https://www.omim.org/entry/610544610544610544

Lead Time Guidance:3-7 business days

View full details