Recombinant Human HLA-DMA protein(HLA-DMA),partial

Recombinant Human HLA-DMA protein(HLA-DMA),partial

CSB-EP338892HU
Regular price
¥82,900 JPY
Sale price
¥82,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cardiovascular

Target / Protein: HLA-DMA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q6ICR9

AA Sequence: VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Tag info: N-terminal 6xHis-tagged

Expression Region: 27-233aa

Protein length: Partial

MW: 27.4 kDa

Alternative Name(s):

Relevance:

Reference: "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.Submitted (MAY-2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share