Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74)

Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74)

SKU:CSB-CF004956HU

Regular price ¥289,600 JPY
Regular price Sale price ¥289,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P04233

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

Protein Names:Recommended name: HLA class II histocompatibility antigen gamma chain Alternative name(s): HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain Short name= Ii p33 CD_antigen= CD74

Gene Names:Name:CD74 Synonyms:DHLAG

Expression Region:1-296

Sequence Info:full length protein

View full details