Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

SKU:CSB-EP008532HU

Regular price ¥109,900 JPY
Regular price Sale price ¥109,900 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: FCER1A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P12319

AA Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 26-205aa

Protein length: Extracellular Domain

MW: 37 kDa

Alternative Name(s): c-epsilon RI-alpha Short name: FcERI IgE Fc receptor subunit alpha

Relevance: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Reference: "The E237G polymorphism of the high-affinity IgE receptor beta chain and asthma."Zhang X., Zhang W., Qiu D., Sandford A., Tan W.C.Ann. Allergy Asthma Immunol. 93:499-503(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details