Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 6B G-protein coupled receptor(U12)

Recombinant Human herpesvirus 6B G-protein coupled receptor(U12)

SKU:CSB-CF889530HKA

Regular price ¥277,400 JPY
Regular price Sale price ¥277,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Uniprot NO.:Q9QJ51

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTVIELSKLLHDEEFKDNASCTSTPTLKTARIIESAVTGITLTASVPMIIIVITTMILY HRVAKHNATSFYVITLFASDFVLMWCVFFMTVNREQLFSFNRFFCQLVYFIYHAVCSYSI SMLAIIATIRYKTLHRRKQTESKTYSTGRNIGILLLASSMCAIPTALFVQINGAKKTTGK CVVYLSSPKAYELFLAVKIVFSFIW

Protein Names:Recommended name: G-protein coupled receptor

Gene Names:Name:U12

Expression Region:1-205

Sequence Info:full length protein

View full details