Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 6A Protein U17(U17-U16)

Recombinant Human herpesvirus 6A Protein U17(U17-U16)

SKU:CSB-CF737964HJZ

Regular price ¥264,700 JPY
Regular price Sale price ¥264,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Uniprot NO.:Q69552

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADERTSDSVKTRYDIALMKLNDIKIAVFRDSLSTYVEQKTGLTIQFNWPKSRCLVISTL CKIPFPTKSAAELQEMCKYQCFVSVLWCVILVFVVKIKLFFLLNKVRYYFAARKDCNYLD MFLSGERRLVMCA

Protein Names:Recommended name: Protein U17

Gene Names:Name:U17/U16

Expression Region:1-133

Sequence Info:full length protein

View full details