Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Group XVI phospholipase A1-A2(PLA2G16)

Recombinant Human Group XVI phospholipase A1-A2(PLA2G16)

SKU:CSB-CF018089HU

Regular price ¥264,300 JPY
Regular price Sale price ¥264,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P53816

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

Protein Names:Recommended name: Group XVI phospholipase A1/A2 EC= 3.1.1.32 EC= 3.1.1.4 Alternative name(s): Adipose-specific phospholipase A2 Short name= AdPLA H-rev 107 protein homolog HRAS-like suppressor 1 HRAS-like suppressor 3 Short name= HRSL3 HREV107-1 HREV107-3 Renal carcinoma antigen NY-REN-65

Gene Names:Name:PLA2G16 Synonyms:HRASLS3, HREV107

Expression Region:1-162

Sequence Info:full length protein

View full details