Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Glycophorin-C(GYPC)

Recombinant Human Glycophorin-C(GYPC)

SKU:CSB-CF010076HU

Regular price ¥257,900 JPY
Regular price Sale price ¥257,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P04921

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

Protein Names:Recommended name: Glycophorin-C Alternative name(s): Glycoconnectin Glycophorin-D Short name= GPD Glycoprotein beta PAS-2' Sialoglycoprotein D CD_antigen= CD236

Gene Names:Name:GYPC Synonyms:GLPC, GPC

Expression Region:1-128

Sequence Info:full length protein

View full details