Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Glioma pathogenesis-related protein 1(GLIPR),partial

Recombinant Human Glioma pathogenesis-related protein 1(GLIPR),partial

SKU:CSB-EP009503HU

Regular price ¥126,700 JPY
Regular price Sale price ¥126,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: P48060

Gene Names: GLIPR1

Organism: Homo sapiens (Human)

AA Sequence: ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR

Expression Region: 22-232aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 28.1 kDa

Alternative Name(s): Protein RTVP-1

Relevance:

Reference: The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors.Murphy E.V., Zhang Y., Zhu W., Biggs J.Gene 159:131-135(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details