Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein(GTSCR1)

Recombinant Human Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein(GTSCR1)

SKU:CSB-CF773031HU

Regular price ¥265,400 JPY
Regular price Sale price ¥265,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q86UQ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQSDIYHPGHSFPSWVLCKVTYTILATASQVGSFARKTHQNGDLQIRGGRGRRESTEIFQ VASVTEGEESPPAICMEVFLFLWFIAPIYACVCRIFKIQVRNTVKNSSTASLAPSISTSE ERQIRIERHHYHLYGQ

Protein Names:Recommended name: Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein

Gene Names:Name:GTSCR1

Expression Region:1-136

Sequence Info:full length protein

View full details