
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P48546
Gene Names:GIPR
Organism:Homo sapiens (Human)
AA Sequence:RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Expression Region:22-138aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
MW:61.2 kDa
Alternative Name(s):Glucose-dependent insulinotropic polypeptide receptor (GIP-R)
Relevance:This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Reference:"Human gastric inhibitory polypeptide receptor: cloning of the gene (GIPR) and cDNA." Yamada Y., Hayami T., Nakamura K., Kaisaki P.J., Someya Y., Wang C.Z., Seino S., Seino Y. Genomics 29:773-776(1995)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
You may also like
-
Recombinant Human Gastric inhibitory polypeptide receptor(GIPR),partial
- Regular price
- ¥121,000 JPY
- Sale price
- ¥121,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Gastric inhibitory polypeptide receptor(GIPR)
- Regular price
- ¥208,500 JPY
- Sale price
- ¥208,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Gastric inhibitory polypeptide receptor(Gipr)
- Regular price
- ¥208,200 JPY
- Sale price
- ¥208,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Gastric inhibitory polypeptide receptor(Gipr)
- Regular price
- ¥207,500 JPY
- Sale price
- ¥207,500 JPY
- Regular price
-
- Unit price
- per
Sold out