Gene Bio Systems
Recombinant Human Galactoside 2-alpha-L-fucosyltransferase 1(FUT1)
Recombinant Human Galactoside 2-alpha-L-fucosyltransferase 1(FUT1)
SKU:CSB-CF009073HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P19526
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
Protein Names:Recommended name: Galactoside 2-alpha-L-fucosyltransferase 1 EC= 2.4.1.69 Alternative name(s): Alpha(1,2)FT 1 Blood group H alpha 2-fucosyltransferase Fucosyltransferase 1 GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
Gene Names:Name:FUT1 Synonyms:H, HSC
Expression Region:1-365
Sequence Info:full length protein
