GeneBio Systems
Recombinant Human Follistatin-related protein 1 (FSTL1), partial
Recombinant Human Follistatin-related protein 1 (FSTL1), partial
SKU:Q12841
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cardiovascular
Uniprot ID: Q12841
Gene Names: FSTL1
Alternative Name(s): (Follistatin-like protein 1)
Abbreviation: Recombinant Human FSTL1 protein, partial
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 176-285aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-GST-tagged
Target Protein Sequence: ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR
MW: 43.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation. Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter. Promotes endothelial cell survival, migration and differentiation into network structures in an AKT-dependent manner. Also promotes survival of cardiac myocytes. Initiates various signaling cascades by activating different receptors on the cell surface such as DIP2A, TLR4 or BMP receptors.
Reference: "Fstl1 Promotes Glioma Growth Through the BMP4/Smad1/5/8 Signaling Pathway." Jin X., Nie E., Zhou X., Zeng A., Yu T., Zhi T., Jiang K., Wang Y., Zhang J., You Y. Cell. Physiol. Biochem. 44: 1616-1628(2017)
Function:
