Gene Bio Systems
Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3(EIF4EBP3)
Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3(EIF4EBP3)
SKU:CSB-EP007565HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: O60516
Gene Names: EIF4EBP3
Organism: Homo sapiens (Human)
AA Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Expression Region: 1-100aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 26.9 kDa
Alternative Name(s):
Relevance: Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.
Reference: 4E-BP3, a new member of the eukaryotic initiation factor 4E-binding protein family.Poulin F., Gingras A.-C., Olsen H., Chevalier S., Sonenberg N.J. Biol. Chem. 273:14002-14007(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
