
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transcription
Uniprot ID: Q13542
Gene Names: EIF4EBP2
Organism: Homo sapiens (Human)
AA Sequence: MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Expression Region: 1-120aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 39.9 kDa
Alternative Name(s):
Relevance: Repressor of translation initiation involved in synaptic plasticity, learning and mory formation . Regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation . EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal st cell renewal via its ability to repress translation initiation . Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways .
Reference: Insulin-dependent stimulation of protein synthesis by phosphorylation of a regulator of 5'-cap function.Pause A., Belsham G.J., Gingras A.-C., Donze O., Lin T.-A., Lawrence J.C. Jr., Sonenberg N.Nature 371:762-767(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 2(EIF4EBP2)
- Regular price
- ¥92,300 JPY
- Sale price
- ¥92,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
EIF4EBP2 antibody , Cat. # FNab02723
- Regular price
- ¥58,600 JPY
- Sale price
- ¥58,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3(EIF4EBP3)
- Regular price
- ¥82,600 JPY
- Sale price
- ¥82,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
EIF4EBP1 Antibody, FITC conjugated - Cat. #: CSB-PA623815LC01HU
- Regular price
- ¥50,300 JPY
- Sale price
- ¥50,300 JPY
- Regular price
-
- Unit price
- per
Sold out