Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ER lumen protein retaining receptor 3(KDELR3)

Recombinant Human ER lumen protein retaining receptor 3(KDELR3)

SKU:CSB-CF012131HU

Regular price ¥278,900 JPY
Regular price Sale price ¥278,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43731

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYN TVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLANWIRRYQTENFYDQIA VVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPMPI

Protein Names:Recommended name: ER lumen protein retaining receptor 3 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 3 Short name= KDEL receptor 3

Gene Names:Name:KDELR3

Expression Region:1-214

Sequence Info:Full length protein

View full details