Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Ephrin-B1(EFNB1)

Recombinant Human Ephrin-B1(EFNB1)

SKU:CSB-CF007465HU

Regular price ¥294,100 JPY
Regular price Sale price ¥294,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P98172

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Protein Names:Recommended name: Ephrin-B1 Alternative name(s): EFL-3 ELK ligand Short name= ELK-L EPH-related receptor tyrosine kinase ligand 2 Short name= LERK-2

Gene Names:Name:EFNB1 Synonyms:EFL3, EPLG2, LERK2

Expression Region:28-346

Sequence Info:full length protein

View full details