Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Elongation of very long chain fatty acids protein 1(ELOVL1)

Recombinant Human Elongation of very long chain fatty acids protein 1(ELOVL1)

SKU:CSB-CF887138HU

Regular price ¥282,400 JPY
Regular price Sale price ¥282,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BW60

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRG FMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFI ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYL YYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYG TIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN

Protein Names:Recommended name: Elongation of very long chain fatty acids protein 1 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase ELOVL1 ELOVL fatty acid elongase 1 Short name= ELOVL FA elongase 1

Gene Names:Name:ELOVL1 Synonyms:SSC1 ORF Names:CGI-88

Expression Region:1-279

Sequence Info:full length protein

View full details