Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Duffy antigen-chemokine receptor(DARC)

Recombinant Human Duffy antigen-chemokine receptor(DARC)

SKU:CSB-CF624105HU

Regular price ¥250,700 JPY
Regular price Sale price ¥250,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q16570

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS ALP

Protein Names:Recommended name: Duffy antigen/chemokine receptorAlternative name(s): Fy glycoprotein Short name= GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen= CD234

Gene Names:Name:DARCSynonyms:FY, GPD

Expression Region:1-63

Sequence Info:full length protein

View full details