Recombinant Human Cytosolic endo-beta-N-acetylglucosaminidase(ENGASE),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Cytosolic endo-beta-N-acetylglucosaminidase(ENGASE),partial

CSB-EP854117HU
Regular price
¥104,600 JPY
Sale price
¥104,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: ENGASE

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q8NFI3

AA Sequence: MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGFFTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVALFAPSCSVFPGVGNLLCC

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-377aa

Protein length: Partial

MW: 59.1 kDa

Alternative Name(s):

Relevance: Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core. Involved in the processing of free oligosaccharides in the cytosol.

Reference: "Endo-beta-N-acetylglucosaminidase, an enzyme involved in processing of free oligosaccharides in the cytosol." Suzuki T., Yano K., Sugimoto S., Kitajima K., Lennarz W.J., Inoue S., Inoue Y., Emori Y. Proc. Natl. Acad. Sci. U.S.A. 99:9691-9696(2002)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Cytosolic endo-beta-N-acetylglucosaminidase(ENGASE),partial
    Regular price
    ¥104,600 JPY
    Sale price
    ¥104,600 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Glucosylceramidase(GBA)
    Regular price
    ¥94,400 JPY
    Sale price
    ¥94,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Glucosylceramidase(GBA)
    Regular price
    ¥81,800 JPY
    Sale price
    ¥81,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human UDP-glucose 6-dehydrogenase(UGDH)
    Regular price
    ¥81,800 JPY
    Sale price
    ¥81,800 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share