Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cytomegalovirus Uncharacterized protein UL42(UL42)

Recombinant Human cytomegalovirus Uncharacterized protein UL42(UL42)

SKU:CSB-CF323728HWV

Regular price ¥227,700 JPY
Regular price Sale price ¥227,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Uniprot NO.:P16815

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEPTPMLRDRDHDDAPPTYEQAMGLCPTTVSTPPPPPPDCSPPPYRPPYCLVSSPSPRHT FDMDMMEMPATMHPTTGAYFDNGWKWTFALLVVAILGIIFLAVVFTVVINRDSANITTGT QASSG

Protein Names:Recommended name: Uncharacterized protein UL42

Gene Names:Name:UL42

Expression Region:1-125

Sequence Info:full length protein

View full details