Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cytomegalovirus Protein UL41A(UL41A)

Recombinant Human cytomegalovirus Protein UL41A(UL41A)

SKU:CSB-CF516617HWV

Regular price ¥253,100 JPY
Regular price Sale price ¥253,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Uniprot NO.:O39920

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLFCRTANSTAGYVDMNVCIGMIGVVCFVFGVFILIFCSTLKAFYVRQKTYHLLGTESD DEETTVWEKRRMESDTDF

Protein Names:Recommended name: Protein UL41A

Gene Names:Name:UL41A

Expression Region:1-78

Sequence Info:full length protein

View full details