Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cysteine-rich tail protein 1(CYSRT1)

Recombinant Human cysteine-rich tail protein 1(CYSRT1)

SKU:CSB-EP2119HUb8

Regular price ¥140,400 JPY
Regular price Sale price ¥140,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: B8A4K4

Gene Names: CYSRT1

Organism: Homo sapiens (Human)

AA Sequence: MAPPLPRREKAAASRSTQALGPRAQKTERTDCRVATTGWTMDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS

Expression Region: 1-184aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-JD-tagged

MW: 25.2 kDa

Alternative Name(s):

Relevance:

Reference: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details